Skip to main content
Addgene

Anti-CALB2 [BCN4.2.3B2]
(Antibody #204683)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 204683-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 204683-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Purification
    Purified from cell culture supernatant using affinity chromatography followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze/thaw cycles.
  • Shipment
    Blue ice or room temp

Terms and Licenses

Target Antigen

Protein Calretinin
Antigen Description Recombinant fragment of human CALB2 protein (aa 23–157)
Antigen Amino Acid Sequence
EIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQ
Species H. sapiens (human)
Additional Species Reactivity M. musculus (mouse),  R. norvegicus (rat)
Gene CALB2
Alternative Names
  • CR
  • 29 kDa calbindin
External References

Applications (1)

Clear filters

Immunocytochemistry

1 image
Immunocytochemistry image by James Trimmer, UC Davis
Submitted By: James Trimmer, UC Davis
Addgene Partner
Antibody Type
Recombinant
Sample Species
H. sapiens (human)
Result
Pass

Addgene Comments

How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-CALB2 [BCN4.2.3B2] - from CDI Laboratories Inc (CDI), Melina Fan (Addgene antibody # 204683 ; http://n2t.net/addgene:204683)
  • For your References section: