pEGFPC2-gephyrin C3
(Plasmid #199610)

• Purpose: Encodes N-terminal eGFP-tagged gephyrin including the C3 splice cassette for expression in mammalian cells.
• Depositing Lab: Shiva Tyagarajan
• Publication: Campbell et al Elife. 2022 Oct 31;11:e80895. doi: 10.7554/eLife.80895.

Backbone

• Vector backbone: pEGFPC2
• Backbone manufacturer: Clontech
• Backbone size w/o insert (bp): 4700
• Vector type: Mammalian Expression
• Selectable markers: Neomycin (select with G418)

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): NEB Stable
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: Gephyrin
• Species: R. norvegicus (rat)
• Mutation: C3 cassette insertion
• Entrez Gene: Gphn (a.k.a. Geph)
• Promoter: CMV
• Tag / Fusion Protein:
  • EGFP (N terminal on backbone)

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: XhoI (unknown if destroyed)
• 3′ cloning site: KpnI (unknown if destroyed)
• 5′ sequencing primer: CGCAAATGGGCGGTAGGCGTG

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons)