Skip to main content
Addgene

Anti-CASK [K56A/50R]
(Antibody #183002)

Print
Western Blot image by Addgene

Image 1 (of 4): Western Blot
Crude rat membranes immunoblotted against Anti-CASK purified recombinant antibody produce… View details
Credit: Addgene

Immunohistochemistry image by Zhuhao Wu, Weill Cornell Medicine

Image 2 (of 4): Immunohistochemistry
Delipidated mouse brain tissue was stained with Anti-CASK [K56A/50R]. View details
Credit: Zhuhao Wu, Weill Cornell Medicine

Western Blot image by James Trimmer, UC Davis

Image 3 (of 4): Western Blot
Crude rat membranes immunoblotted against Anti-CASK purified recombinant antibody produce… View details
Credit: James Trimmer, UC Davis

Immunohistochemistry image by James Trimmer, UC Davis

Image 4 (of 4): Immunohistochemistry
Free-floating rat brain sections were fixed and stained with purified recombinant Anti-CA… View details
Credit: James Trimmer, UC Davis

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 183002-rAb 100 µg of purified recombinant antibody $250 *
Add to Cart
Recombinant Antibody trial size 183002-rAb.T 20 µg of purified recombinant antibody $85 *
Add to Cart

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-CASK [K56A/50R]
  • Antigen Plasmid
    CASK/GW1
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750669

Terms and Licenses

Target Antigen

Protein Peripheral plasma membrane protein CASK
Antigen Description Amino acids 318–415 (first L27 domain) of human Peripheral plasma membrane protein CASK
Antigen Amino Acid Sequence
NSFYGDPPEELPDFSEDPTSSGLLAAERAV SQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSP QIRNPPSDAVQRAKEVLEE
Species H. sapiens (human)
Additional Species Reactivity M. musculus (mouse),  R. norvegicus (rat),  X. laevis (frog),  D. rerio (zebrafish)
Gene CASK
Alternative Names
  • hCASK
  • Calcium/calmodulin-dependent serine protein kinase
  • Protein lin-2 homolog
External References

Applications (2)

Information
Clear filters

Immunohistochemistry

Recommended
1 image
Immunohistochemistry image by Zhuhao Wu, Weill Cornell Medicine
Submitted By: Zhuhao Wu, Weill Cornell Medicine
Addgene Partner
Antibody Type
Recombinant
Sample Species
M. musculus (mouse)
Result
Pass
View Details

Western Blot

Recommended
1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass
View Details
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-CASK [K56A/50R] - from James Trimmer (Addgene antibody # 183002 ; http://n2t.net/addgene:183002 ; RRID:AB_2750669)

  • For your References section:

    High-volume hybridoma sequencing on the NeuroMabSeq platform enables efficient generation of recombinant monoclonal antibodies and scFvs for neuroscience research. Mitchell KG, Gong B, Hunter SS, Burkart-Waco D, Gavira-O'Neill CE, Templeton KM, Goethel ME, Bzymek M, MacNiven LM, Murray KD, Settles ML, Froenicke L, Trimmer JS. Sci Rep. 2023 Sep 27;13(1):16200. doi: 10.1038/s41598-023-43233-4. 10.1038/s41598-023-43233-4 PubMed 37758930