Skip to main content
Addgene

Anti-Pan-QKI [N147/6.1R]
(Antibody #180114)

Print
Immunohistochemistry image by

Image 1 (of 3): Immunohistochemistry
Free-floating rat brain sections were fixed and stained with purified Anti-Pan-QKI [N147/… View details

Immunohistochemistry image by Zhuhao Wu, Weill Cornell Medicine

Image 2 (of 3): Immunohistochemistry
Delipidated mouse brain tissue was stained with Anti-Pan-QKI [N147/6.1R]. View details
Credit: Zhuhao Wu, Weill Cornell Medicine

Western Blot image by James Trimmer, UC Davis

Image 3 (of 3): Western Blot
Crude rat membranes immunoblotted against Anti-Pan-QKI hybridoma-derived antibody from th… View details
Credit: James Trimmer, UC Davis

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 180114-rAb 100 µg of purified recombinant antibody $250 *
Add to Cart
Recombinant Antibody trial size 180114-rAb.T 20 µg of purified recombinant antibody $85 *
Add to Cart

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Pan-QKI [N147/6.1R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750719

Terms and Licenses

Target Antigen

Protein Protein quaking
Antigen Description Amino acids 1–341 (full-length) of human QKI-5
Antigen Amino Acid Sequence
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Species H. sapiens (human)
Additional Species Reactivity M. musculus (mouse),  R. norvegicus (rat)
Gene QKI
External References

Applications (2)

Information
Clear filters

Immunohistochemistry

Recommended
1 image
Immunohistochemistry image by Zhuhao Wu, Weill Cornell Medicine
Submitted By: Zhuhao Wu, Weill Cornell Medicine
Addgene Partner
Antibody Type
Recombinant
Sample Species
M. musculus (mouse)
Result
Pass
View Details

Western Blot

Recommended
1 image
Western Blot image by
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass
View Details
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Pan-QKI [N147/6.1R] - from James Trimmer (Addgene antibody # 180114 ; http://n2t.net/addgene:180114 ; RRID:AB_2750719)

  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360