mCherry-Cb5-IRES-puromycin-pLVx-EF1a
(Plasmid #177434)

• Purpose: To express mCherry fused to Cb5 endoplasmic reticulum (ER) targeting sequence. Lentiviral vector used to make cell lines expressing this ER landmark.
• Depositing Lab: David Andrews
• Publication: David Andrews Lab plasmids (unpublished)

Backbone

• Vector backbone: pLVX-EF1a-IRES-Puromycin
• Vector type: Mammalian Expression, Lentiviral
• Selectable markers: Puromycin

Growth in Bacteria

• Bacterial Resistance(s): Ampicillin, 100 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): NEB Stable
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: Cb5 tail anchor
• Alt name: mCherry-Cb5, Ch-Cb5, ChCb5
• Species: R. norvegicus (rat)
• Entrez Gene: Cyb5r4 (a.k.a. Ncb5or, b5&b5R, b5+b5R, cb5/cb5R)
• Promoter: EF1a
• Tag / Fusion Protein:
  • mCherry (N terminal on insert)

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ sequencing primer: aagcgcgatcacatggtcctg

Resource Information

• Supplemental Documents:
  • mCherry-Cb5-IRES-Puromycin-plVx-EF1a.gbk
• A portion of this plasmid was derived from a plasmid made by: See gene entry for "cytochrome b5 [R. norvegicus]", See NCBI Reference Sequence: NP_071581.1. Here we have used only the C-terminal tail anchor sequence. mCherry sequence matches GenBank: AZP55984.1.

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
  • Takara Bio Limited Use Label License (formerly Clontech)
• Industry Terms:
  • Not Available to Industry

Depositor Comments

Infection with this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence" "ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED", which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker "SGLRSGK", between mCherry and Cb5.