Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

JPUB_006826
(Plasmid #87923)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 87923 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pET28
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    NEB Stable
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    Kuste3608
  • Species
    K. stuttgartiensis
  • Promoter T7
  • Tag / Fusion Protein
    • 6xHis (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site unknown (unknown if destroyed)
  • 3′ cloning site unknown (unknown if destroyed)
  • 5′ sequencing primer T7
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

protein sequence: MGSSHHHHHHSSGLVPRGSHMKKMMLINPHKPGRHGEESITVIVQMPLNLAYIKALTPGDWEFDVIDENIELAIDDNGELTFAPVDLVCITSVTYQSPRAYKIATACKRKGMTVIMGGIHASVMPEEASKYVDTVFIGEAEEVWPRVIKDFEAGKLKKVYDGGLPPLNLMKRVFPDREFLRKKYNYKFSSIVTTKGCPNYCDFCSVPTFQGRKFRERPYEDVLEELAATDYKGLMLAEDNFYGHGKRSNERARNLFKGMVERNLQKDWLGFTALNISQDKETLDYMAKSGCFGMLMGIESTNETVLEKMNKQVNLKLGTESYYDCIQKIHDAGLVTWGSVVFGADGDGKDSFKRMTDFILENNIDILTFGINCPFPKTQLYKRLDSEKRIFRKNYPDDWEYYDTAHVVHRLVDMTLEDFIEGMQYVYDHIYAGDNLRKRFRNSIKTTNNPRNSMFAFRVGSDWQQVFDQVLENLRLLYDSGDYYKDYYKSNSVSVSKKPLVESITT-

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    JPUB_006826 was a gift from Harry Beller (Addgene plasmid # 87923 ; http://n2t.net/addgene:87923 ; RRID:Addgene_87923)
  • For your References section:

    Investigation of Proposed Ladderane Biosynthetic Genes from Anammox Bacteria by Heterologous Expression in E. coli. Javidpour P, Deutsch S, Mutalik VK, Hillson NJ, Petzold CJ, Keasling JD, Beller HR. PLoS One. 2016 Mar 14;11(3):e0151087. doi: 10.1371/journal.pone.0151087. eCollection 2016. PONE-D-16-02052 [pii] PubMed 26975050