Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

pCMV6-G2-ATP8-V5 (puromycin)
(Plasmid #86852)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 86852 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pCMV6
  • Vector type
    Mammalian Expression
  • Selectable markers
    Puromycin

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    ATP8
  • Species
    H. sapiens (human)
  • Mutation
    codon optimized
  • Entrez Gene
    ATP8 (a.k.a. ATPase8, MTATP8)
  • Promoter CMV
  • Tags / Fusion Proteins
    • ATP5G2 (G2) mitochondrial targeting signal (N terminal on insert)
    • V5 (C terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site MluI (unknown if destroyed)
  • 3′ cloning site XhoI (unknown if destroyed)
  • 5′ sequencing primer CMV-F
  • 3′ sequencing primer M13-Rev
  • (Common Sequencing Primers)

Resource Information

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

ATP5G2 (G2) targeting sequence is: MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pCMV6-G2-ATP8-V5 (puromycin) was a gift from Matthew O'Connor (Addgene plasmid # 86852 ; http://n2t.net/addgene:86852 ; RRID:Addgene_86852)
  • For your References section:

    Stable nuclear expression of ATP8 and ATP6 genes rescues a mtDNA Complex V null mutant. Boominathan A, Vanhoozer S, Basisty N, Powers K, Crampton AL, Wang X, Friedricks N, Schilling B, Brand MD, O'Connor MS. Nucleic Acids Res. 2016 Nov 2;44(19):9342-9357. Epub 2016 Sep 4. 10.1093/nar/gkw756 PubMed 27596602