pCMV6-G1-ATP8-Myc-FLAG (G418)
(Plasmid
#86850)
-
Purposemammalian expression of ATP8 with mitochondrial targeting sequence, Myc, and FLAG tags
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 86850 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backbonepCMV6
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert nameATP8
-
SpeciesH. sapiens (human)
-
Mutationcodon optimized
-
Entrez GeneATP8 (a.k.a. ATPase8, MTATP8)
- Promoter CMV
-
Tags
/ Fusion Proteins
- ATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTA) (N terminal on insert)
- myc (C terminal on backbone)
- FLAG (C terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site MluI (unknown if destroyed)
- 3′ cloning site XhoI (unknown if destroyed)
- 5′ sequencing primer CMV-F
- 3′ sequencing primer M13-Rev (Common Sequencing Primers)
Resource Information
-
Supplemental Documents
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pCMV6-G1-ATP8-Myc-FLAG (G418) was a gift from Matthew O'Connor (Addgene plasmid # 86850 ; http://n2t.net/addgene:86850 ; RRID:Addgene_86850) -
For your References section:
Stable nuclear expression of ATP8 and ATP6 genes rescues a mtDNA Complex V null mutant. Boominathan A, Vanhoozer S, Basisty N, Powers K, Crampton AL, Wang X, Friedricks N, Schilling B, Brand MD, O'Connor MS. Nucleic Acids Res. 2016 Nov 2;44(19):9342-9357. Epub 2016 Sep 4. 10.1093/nar/gkw756 PubMed 27596602