8xGliBS-IVS2-mCherry-NLS-Odc1-polyA-Tol2
(Plasmid #84603)

• Purpose: Tol2-based hedgehog signal reporter plasmid for zebrafish transgenesis
• Depositing Lab: James Chen
• Publication: Mich et al PLoS One. 2014 Jul 28;9(7):e103661. doi: 10.1371/journal.pone.0103661. eCollection 2014.

Backbone

• Vector backbone: pT2KXIG
• Backbone manufacturer: K. Kawakami lab
• Vector type: Zebrafish transgenesis

Growth in Bacteria

• Bacterial Resistance(s): Ampicillin, 100 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Unknown

Gene/Insert

• Gene/Insert name: mCherry
• Species: Synthetic
• Promoter: 8xGliBS-delta-crystallin minimal promoter
• Tag / Fusion Protein:
  • ODC1 destabilizing element (C terminal on insert)

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: XhoI (not destroyed)
• 3′ cloning site: EcoRI (not destroyed)
• 5′ sequencing primer: pBluescript-SK
• 3′ sequencing primer: unknown

Resource Information

• Supplemental Documents:
  • 84603-genbank
• A portion of this plasmid was derived from a plasmid made by: mCherry from pRSET-mCherry (R. Tsien); 8xGliBS-delta-crystallin from 8xGliBS-Luciferase (H. Kondoh), Odc1 from d1EGFP (Clontech)
• Article Citing this Plasmid:
  • 1 Reference

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
  • National Institute of Genetics Limited Use Label License for Tol2 System
  • Takara Bio Limited Use Label License (formerly Clontech)
• Industry Terms:
  • Not Available to Industry

Depositor Comments

The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.