Skip to main content
Addgene

pC-FLAG-ZCD2
(Plasmid #79274)

Full plasmid sequence is not available for this item.

Loading...

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 79274 Standard format: Plasmid sent in bacteria as agar stab 1 $85 *

* Log in to view industry pricing.

Backbone

  • Vector backbone
    pDEST26-C-FLAG
  • Backbone size w/o insert (bp) 7500
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    ZCD2
  • Species
    H. sapiens (human)
  • Entrez Gene
    CISD2 (a.k.a. ERIS, Miner1, NAF-1, WFS2, ZCD2)
  • Promoter CMV
  • Tag / Fusion Protein
    • FLAG (C terminal on backbone)

Cloning Information

Terms and Licenses

Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Please note that the amino acid sequence LKEPIQSTGSGTEFPGYRRPTRPGSGEEWTPLAR is inserted before the start of the ZCD2 sequence. The depositor noted that this sequence does NOT affect plasmid function.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pC-FLAG-ZCD2 was a gift from Rita Shiang (Addgene plasmid # 79274 ; http://n2t.net/addgene:79274 ; RRID:Addgene_79274)
  • For your References section:

    A homozygous mutation in a novel zinc-finger protein, ERIS, is responsible for Wolfram syndrome 2. Amr S, Heisey C, Zhang M, Xia XJ, Shows KH, Ajlouni K, Pandya A, Satin LS, El-Shanti H, Shiang R. Am J Hum Genet. 2007 Oct;81(4):673-83. Epub 2007 Aug 20. 10.1086/520961 PubMed 17846994