pJK377
(Plasmid
#72411)
-
PurposeProduces Acetobacter aceti 1023 Est05
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 72411 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backbonepET23d
- Backbone size w/o insert (bp) 3663
- Total vector size (bp) 5651
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert namehypothetical protein
-
Alt nameest05
-
Alt nameAAC0474
-
Alt nameAZ09_11650
-
SpeciesAcetobacter aceti 1023
-
Mutationadditional N-terminal MTFLYSICHIVMNIVSSTPHFNVWICFAESI sequence, alternate start codon
-
GenBank IDKDE19622.1 WP_042788437.1
- Promoter T7
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site NcoI (not destroyed)
- 3′ cloning site XhoI (not destroyed)
- 5′ sequencing primer T7 promoter
- 3′ sequencing primer T7 terminator (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pJK377 was a gift from T. J. Kappock (Addgene plasmid # 72411 ; http://n2t.net/addgene:72411 ; RRID:Addgene_72411)