pET28-At_PRORP1-His
(Plasmid #67869)

• Purpose: bacterial expression of PRORP1 (At2g32230), full coding sequence (mitoch./chloropl. form) + C-term. His tag
• Depositing Lab: Walter Rossmanith
• Publication: Pavlova et al Chembiochem. 2012 Oct 15;13(15):2270-6. doi: 10.1002/cbic.201200434. Epub 2012 Sep 13.

Backbone

• Vector backbone: pET28-b(+)
• Backbone manufacturer: Novagen
• Backbone size w/o insert (bp): 5369
• Vector type: Bacterial Expression

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Low Copy

Gene/Insert

• Gene/Insert name: PRORP1
• Alt name: At2g32230
• Species: A. thaliana (mustard weed)
• Insert Size (bp): 1611
• Mutation: Residues 36-572 (see comments)
• GenBank ID: 817782
• Entrez Gene: PRORP1 (a.k.a. AT2G32230, F22D22.2, F22D22_2, proteinaceous RNase P 1)
• Promoter: T7
• Tag / Fusion Protein:
  • His (C terminal on backbone)

Cloning Information

• Cloning method: Unknown
• 5′ sequencing primer: T7
• 3′ sequencing primer: T7 Terminal

Resource Information

• Supplemental Documents:
  • pET28-At_PRORP1-His sequence file

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”