pUC19 gene 60 thru gap + Cys
(Plasmid #49161)

• Purpose: Template for generating gene 60 mRNA truncated two codons after coding gap + Cys
• Depositing Lab: Nils Walter
• Publication: Todd et al RNA. 2013 May;19(5):685-700. doi: 10.1261/rna.037291.112. Epub 2013 Mar 14.

Backbone

• Vector backbone: pUC19
• Backbone size w/o insert (bp): 2662
• Total vector size (bp): 2986

Growth in Bacteria

• Bacterial Resistance(s): Ampicillin, 100 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): JM109
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: Bacteriophage T4 gene 60
• Species: Enterobacteria phage T4
• Insert Size (bp): 324
• Mutation: gene 60 mRNA truncated two codons after coding gap; Cysteine added as reporter for in vitro translation.
• GenBank ID: M19728.1
• Promoter: T7

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: XbaI (not destroyed)
• 3′ cloning site: HindIII (not destroyed)
• 5′ sequencing primer: M13 fwd
• 3′ sequencing primer: M13 rev

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

This plasmid has a "coding gap," a unique feature of this gene that is similar to a programed ribosomal frame shift, but larger.

The gene60 mutant in this plasmid is composed of two discontinuous reading frames (corresponding to nts 77-214 and 265-76 of Addgene's sequencing result with M13pUC-Fwd primer), and the resulting protein sequence is MKFVKIDSSSVDMKKYKLQNNVRRSIKSSSMNYANVAIMTDADHDG^LGC*, where ^ indicates nts 215-64 that get skipped by the ribosome.