Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

pUC19 gene 60 thru gap + Cys
(Plasmid #49161)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 49161 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pUC19
  • Backbone size w/o insert (bp) 2662
  • Total vector size (bp) 2986

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    JM109
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    Bacteriophage T4 gene 60
  • Species
    Enterobacteria phage T4
  • Insert Size (bp)
    324
  • Mutation
    gene 60 mRNA truncated two codons after coding gap; Cysteine added as reporter for in vitro translation.
  • GenBank ID
    M19728.1
  • Promoter T7

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site XbaI (not destroyed)
  • 3′ cloning site HindIII (not destroyed)
  • 5′ sequencing primer M13 fwd
  • 3′ sequencing primer M13 rev
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

This plasmid has a "coding gap," a unique feature of this gene that is similar to a programed ribosomal frame shift, but larger.

The gene60 mutant in this plasmid is composed of two discontinuous reading frames (corresponding to nts 77-214 and 265-76 of Addgene's sequencing result with M13pUC-Fwd primer), and the resulting protein sequence is MKFVKIDSSSVDMKKYKLQNNVRRSIKSSSMNYANVAIMTDADHDG^LGC*, where ^ indicates nts 215-64 that get skipped by the ribosome.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pUC19 gene 60 thru gap + Cys was a gift from Nils Walter (Addgene plasmid # 49161 ; http://n2t.net/addgene:49161 ; RRID:Addgene_49161)
  • For your References section:

    Secondary structure of bacteriophage T4 gene 60 mRNA: implications for translational bypassing. Todd GC, Walter NG. RNA. 2013 May;19(5):685-700. doi: 10.1261/rna.037291.112. Epub 2013 Mar 14. 10.1261/rna.037291.112 PubMed 23492219