pTYB1-pLAC-N45
(Plasmid
#48718)
-
PurposeBacterial expression of Lacritin protein with 45 AA removed from N terminus
-
Depositing Lab
-
Sequence Information
Full plasmid sequence is not available for this item.
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 48718 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backbonepTYB1
-
Backbone manufacturerNew England BioLabs, INC
- Backbone size w/o insert (bp) 7477
- Total vector size (bp) 229
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)ER2566
-
Growth instructionsBacterial Strain was selected due to its ability to efficiently express mammalian protein (non-glycosolated) in bacterial cells.
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameLacritin
-
Alt nameLACRT
-
Alt namepLAC
-
SpeciesH. sapiens (human)
-
Insert Size (bp)360
-
MutationDeleted first 45 amino acids of mature lacritin without signal peptide
-
GenBank IDNM_033277.1
-
Entrez GeneLACRT
-
Tag
/ Fusion Protein
- Intein (C terminal on insert)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site EcoRI (unknown if destroyed)
- 3′ cloning site EcoRI (unknown if destroyed)
- 5′ sequencing primer ATGGGCGGCAGCAGTTCA
- 3′ sequencing primer TCATGCCCATGGTTTTAA (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pTYB1-pLAC-N45 was a gift from Gordon Laurie (Addgene plasmid # 48718 ; http://n2t.net/addgene:48718 ; RRID:Addgene_48718) -
For your References section:
Lacritin rescues stressed epithelia via rapid forkhead box O3 (FOXO3)-associated autophagy that restores metabolism. Wang N, Zimmerman K, Raab RW, McKown RL, Hutnik CM, Talla V, Tyler MF 4th, Lee JK, Laurie GW. J Biol Chem. 2013 Jun 21;288(25):18146-61. doi: 10.1074/jbc.M112.436584. Epub 2013 May 2. 10.1074/jbc.M112.436584 PubMed 23640897
Map uploaded by the depositor.
![](https://media.addgene.org/data/easy-thumbnails/data/04/08/b9d72060-1b02-11e3-b31d-000c29055998.jpeg.940x940_q85_autocrop.png)