L3MBTL3 (3UT1)
(Plasmid #36901)

• Purpose: Bacterial expression for structure determination; may not be full ORF
• Depositing Lab: Cheryl Arrowsmith
• Publication: SGC Q3&Q4 2011 (unpublished)

Backbone

• Vector backbone: pET28-SBP-TEV
• Backbone manufacturer: SGC (Addgene plasmid 36943)
• Backbone size w/o insert (bp): 7445
• Total vector size (bp): 8414
• Vector type: Bacterial Expression

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Low Copy

Gene/Insert

• Gene/Insert name: L3MBTL3
• Alt name: PDB: 3UT1
• Alt name: Lethal(3)malignant brain tumor-like protein 3, 3 MBT repeats
• Species: H. sapiens (human)
• Insert Size (bp): 969
• Mutation: contains amino acid residues 228-551 only
• GenBank ID: BC060845
• Entrez Gene: L3MBTL3 (a.k.a. MBT-1, MBT1)
• Tags / Fusion Proteins:
  • His tag (N terminal on backbone)
  • Streptavidin-Binding Peptide (SBP)-Tag with TEV cleavage (N terminal on insert)

Cloning Information

• Cloning method: Ligation Independent Cloning
• 5′ sequencing primer: T7
• 3′ sequencing primer: T7-term

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Industry MTA

Depositor Comments

PDB: 3UT1. http://www.thesgc.org/structures/3UT1/

N-terminal tag: MHHHHHHEFMDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPSSGRENLYFQG