CMV500 A-CREB
(Plasmid #33371)

• Depositing Lab: Charles Vinson
• Publication: Ahn et al Mol Cell Biol. 1998 Feb . 18(2):967-77.

Backbone

• Vector backbone: CMV500
• Backbone size w/o insert (bp): 5500
• Vector type: Mammalian Expression

Growth in Bacteria

• Bacterial Resistance(s): Ampicillin, 100 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: CREB
• Alt name: Acidic cAMP Response Element Binding Protein
• Alt name: A-CREB
• Species: M. musculus (mouse)
• Mutation: Dominant Negative (see notes)
• GenBank ID: NM_133828
• Entrez Gene: Creb1 (a.k.a. 2310001E10Rik, 3526402H21Rik, Creb, Creb-1)
• Promoter: CMV
• Tag / Fusion Protein:
  • FLAG (N terminal on insert)

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: NdeI (not destroyed)
• 3′ cloning site: HindIII (not destroyed)
• 5′ sequencing primer: CMV-Fwd
• 3′ sequencing primer: BGH-Rev

Resource Information

• Articles Citing this Plasmid:
  • 4 References

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.