Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

PCDF Bravo-PotH-OL3/2sub
(Plasmid #216752)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 216752 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    PCDF Bravo
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Streptomycin, 50 μg/mL
  • Growth Temperature
    Room Temperature
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Low Copy

Gene/Insert

  • Gene/Insert name
    potH
  • Species
    E. coli (Bacteria)
  • Mutation
    Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW].
  • Entrez Gene
    potH (a.k.a. b0856, ECK0847)
  • Tag / Fusion Protein
    • 10x His (C terminal on insert)

Cloning Information

  • Cloning method Ligation Independent Cloning

Resource Information

  • A portion of this plasmid was derived from a plasmid made by
    DNASU Plasmid Repository (ID: EcCD00397460)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

IPTG inducible

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    PCDF Bravo-PotH-OL3/2sub was a gift from Gordon Laurie (Addgene plasmid # 216752 ; http://n2t.net/addgene:216752 ; RRID:Addgene_216752)