pNLF1-N_WDR81:1-745
(Plasmid
#211003)
-
PurposeMammalian expression of human WDR81 fragment M1 to L745. N-terminal NanoLuc luciferase tag.
-
Depositing Lab
-
Publication
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 211003 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backbonepNLF1-N
-
Backbone manufacturerPromega
-
Vector typeMammalian Expression
-
Selectable markersHygromycin
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameWDR81:M1-L745
-
SpeciesH. sapiens (human)
-
Insert Size (bp)2235
-
Mutationwild type
-
Entrez GeneWDR81 (a.k.a. CAMRQ2, HYC3, PPP1R166, SORF-2)
- Promoter CMV
-
Tag
/ Fusion Protein
- NanoLuc luciferase (N terminal on insert)
Cloning Information
- Cloning method Ligation Independent Cloning
- 5′ sequencing primer gtaaccatcaacggagtgac
- 3′ sequencing primer tatcatgtctgctcgaagc (Common Sequencing Primers)
Resource Information
-
A portion of this plasmid was derived from a plasmid made byMammalian Gene Collection (BC114568)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pNLF1-N_WDR81:1-745 was a gift from Cheryl Arrowsmith (Addgene plasmid # 211003 ; http://n2t.net/addgene:211003 ; RRID:Addgene_211003) -
For your References section:
A resource to enable chemical biology and drug discovery of WDR Proteins. Ackloo S, Li F, Szewczyk M, Seitova A, Loppnau P, Zeng H, Xu J, Ahmad S, Arnautova Y, Baghaie A, Beldar S, Bolotokova A, Centrella P, Chau I, Clark M, Cuozzo J, Dehghani-Tafti S, Disch J, Dong A, Dumas A, Feng J, Ghiabi P, Gibson E, Gilmer J, Goldman B, Green S, Guié M, Guilinger J, Harms N, Herasymenko O, Houliston S, Hutchinson A, Kearnes S, Keefe A, Kimani S, Kramer T, Kutera M, Kwak H, Lento C, Li Y, Liu J, Loup J, Machado R, Mulhern C, Perveen S, Righetto G, Riley P, Shrestha S, Sigel E, Silva M, Sintchak M, Slakman B, Taylor R, Thompson J, Torng W, Underkoffler C, Rechenberg M, Watson I, Wilson D, Wolf E, Yadav M, Yazdi A, Zhang J, Zhang Y, Santhakumar V, Edwards A, Barsyte-Lovejoy D, Schapira M, Brown P, Halabelian L, Arrowsmith C. bioRxiv 2024.03.03.583197 10.1101/2024.03.03.583197