pFBOH-avi-TEV-LIC_DCAF12:1-453
(Plasmid
#210940)
-
PurposeInsect expression of full-length human DCAF12. N-terminal 6X His tag, biotin acceptor peptide tag and TEV cleavage site.
-
Depositing Lab
-
Publication
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 210940 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backbonepFBOH-avi-TEV-LIC
-
Backbone manufacturerpFASTBac1 Modified
-
Vector typeInsect Expression
-
Selectable markersGentamicin
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameDCAF12:M1-S453
-
SpeciesH. sapiens (human)
-
Insert Size (bp)1359
-
MutationR131Q natural variant (VAR_035322)
-
Entrez GeneDCAF12 (a.k.a. CT102, TCC52, WDR40A, MGC1058, KIAA1892, DKFZp434O125)
- Promoter Polyhedrin
Cloning Information
- Cloning method Ligation Independent Cloning
- 5′ sequencing primer tattccggattattcataccg
- 3′ sequencing primer ctctacaaatgtggtatggc (Common Sequencing Primers)
Resource Information
-
A portion of this plasmid was derived from a plasmid made byMammalian Gene Collection (BC063823)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
5' Cloning Site: BseRI (destroyed), 3' Cloning Site: BseRI (destroyed). N terminal tag: MHHHHHHEFMSGLNDIFEAQKIEWHEGSAGGSGENLYFQG.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pFBOH-avi-TEV-LIC_DCAF12:1-453 was a gift from Cheryl Arrowsmith (Addgene plasmid # 210940 ; http://n2t.net/addgene:210940 ; RRID:Addgene_210940) -
For your References section:
A resource to enable chemical biology and drug discovery of WDR Proteins. Ackloo S, Li F, Szewczyk M, Seitova A, Loppnau P, Zeng H, Xu J, Ahmad S, Arnautova Y, Baghaie A, Beldar S, Bolotokova A, Centrella P, Chau I, Clark M, Cuozzo J, Dehghani-Tafti S, Disch J, Dong A, Dumas A, Feng J, Ghiabi P, Gibson E, Gilmer J, Goldman B, Green S, Guié M, Guilinger J, Harms N, Herasymenko O, Houliston S, Hutchinson A, Kearnes S, Keefe A, Kimani S, Kramer T, Kutera M, Kwak H, Lento C, Li Y, Liu J, Loup J, Machado R, Mulhern C, Perveen S, Righetto G, Riley P, Shrestha S, Sigel E, Silva M, Sintchak M, Slakman B, Taylor R, Thompson J, Torng W, Underkoffler C, Rechenberg M, Watson I, Wilson D, Wolf E, Yadav M, Yazdi A, Zhang J, Zhang Y, Santhakumar V, Edwards A, Barsyte-Lovejoy D, Schapira M, Brown P, Halabelian L, Arrowsmith C. bioRxiv 2024.03.03.583197 10.1101/2024.03.03.583197