Skip to main content

Anti-GAD1 [BCN49.2.3D1]
(Antibody #210068)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 210068-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 210068-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Purification
    Purified from cell culture supernatant using affinity chromatography followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice

Resource Information

  • Persistent Resource Identifier
    RRID:AB_3712503

Terms and Licenses

Target Antigen

Protein Glutamate decarboxylase 1
Antigen Description Recombinant fragment of human GAD1 protein (aa 72–135)
Antigen Amino Acid Sequence
NLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS
Species H. sapiens (human)
Gene GAD1
Alternative Names
  • 67 kDa glutamic acid decarboxylase
  • GAD-67
  • Glutamate decarboxylase 67 kDa isoform
External References

Applications (1)

Immunocytochemistry

1 image
Immunocytochemistry image by James Trimmer, UC Davis
Submitted By: James Trimmer, UC Davis
Addgene Partner
Antibody Type
Recombinant
Target Species
Other
Result
Pass

Addgene Comments

How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-GAD1 [BCN49.2.3D1] - from CDI Laboratories Inc (CDI), Melina Fan (Addgene antibody # 210068 ; http://n2t.net/addgene:210068 ; RRID:AB_3712503)
  • For your References section: