Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

Anti-TRIP8b (exon 4) [N212/3R]
(Antibody #209578)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 209578-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 209578-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-TRIP8b (exon 4) [N212/3R]
  • Purification
    Purification from cell culture supernatant using affinity chromatography followed by buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750749

Terms and Licenses

Target Antigen

Protein PEX5-related protein
Antigen Description Amino acids 1–192 (exon 1a, exon 4, and constant region) of rat TRIP8b
Antigen Amino Acid Sequence
MYQGHMQGKGSRAADKAVAMVMKEIPREESAEEKPLLTMTSQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKSESSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRAGSKELLWSSEHRS
Species R. norvegicus (rat)
Additional Species Reactivity H. sapiens (human),  M. musculus (mouse)
Gene Pex5l
Alternative Names
  • PEX5-like protein
  • Peroxin-5-related protein
  • TPR-containing Rab8b-interacting protein
  • Tetratricopeptide repeat-containing Rab8b-interacting protein
  • Pex5Rp
  • TRIP8b
External References

Applications (5)

Clear filters

Immunohistochemistry

1 image
Immunohistochemistry image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
R. norvegicus (rat)
Result
Pass

Western Blot

1 image
Western Blot image by James Trimmer, UC Davis
Submitted By: James Trimmer, UC Davis
Addgene Partner
Antibody Type
Recombinant
Sample Species
R. norvegicus (rat)
Result
Pass
1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
Other
Result
Pass
1 image
Western Blot image by UC Davis/NIH NeuroMab Facility Knockout validation
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass
2 images
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
R. norvegicus (rat)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-TRIP8b (exon 4) [N212/3R] - from James Trimmer (Addgene antibody # 209578 ; http://n2t.net/addgene:209578 ; RRID:AB_2750749)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360