Anti-VGlut1 [N28/9R] - Chimeric
(Antibody #198265)

• Purpose: Anti-VGlut1 (Rat) chimeric recombinant antibody. The hybridoma-derived heavy chain variable sequence and kappa light chain are fused to a rabbit IgG Fc.
• Depositing Labs: Melina Fan, James Trimmer
• Publication: Andrews et al Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322.
• Recommended Applications: Western Blot

Features

• Source Species: O. cuniculus (rabbit)
• Isotype: IgG
• Light Chain Type: kappa
• Amino Acid Sequences:
  Sequences (2) — Accept Affinity Reagent Sequence Policy

Production & Usage

• Purification: Purified from cell culture supernatant using affinity chromatography followed by a buffer exchange with centrifugal columns.
• Storage Buffer: PBS + 1 mM sodium azide

Delivery

• Concentration: 0.9–1.1 mg/mL
• Storage: Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
• Shipment: Blue ice or room temp

Resource Information

• Persistent Resource Identifier: RRID:AB_2929019

Terms and Licenses

• Academic/Nonprofit Terms:
  • Research Use Only Terms
• Industry Terms:
  • Research Use Only Terms

Target Antigen

Protein	Vesicular glutamate transporter 1
Antigen Description	Amino acids 493–560 (cytoplasmic C-terminus) of rat VGlut1
Antigen Amino Acid Sequence	EKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY View Entire Sequence
Species	R. norvegicus (rat)
Gene	Slc17a7
Alternative Names	Brain-specific Na(+)-dependent inorganic phosphate cotransporter Solute carrier family 17 member 7
External References	Uniprot ID: Q62634

Applications (1)

Assay

Western Blot

Sample Species

R. norvegicus (rat)

Result

Pass

Information

Application Information

×

Quality Control

Each lot of antibody undergoes testing, either in-house or through outside labs, to confirm recognition of the expected target or to confirm expected labeling across a tissue panel in one of the antibody’s recommended applications. The specific experiments performed varies for each antibody catalog item. Whenever possible, the experiment is performed in parallel with a previous lot of recombinant antibody or the hybridoma-derived equivalent to ensure potency and specificity have been retained.

Learn more: Antibody Production

Recommended Applications

These recommendations are based on a thorough review of experiments performed at Addgene or at outside labs. Addgene has partnered with outside labs in order to provide careful testing of our antibodies in applications that we are not able to test at our own facilities. Addgene works carefully with these trusted partner labs to ensure that experiments include proper controls and sufficient experimental details and these labs are denoted below with an “Addgene Partner” badge. Please note that we show results for applications that work well with our antibody (Recommended) as well as those that do not (Not recommended) so be sure to check the result!

Antibody Type

Many of Addgene’s recombinant antibodies encode sequences that were originally derived from hybridoma lines. In many cases, we provide results from assays performed with this hybridoma-derived antibody in addition to results from assays performed with the recombinant antibody. To prevent confusion, the application data represented on Addgene’s website clearly notes whether the hybridoma material or recombinant antibody material were used in the assay. In some cases, Recommended Applications are based on results from experiments performed with a hybridoma-derived antibody. If you have any trouble with the recombinant antibody for this same application please contact us at .

Clear filters

Western Blot

Recommended

1 image

Submitted By:: Addgene

Antibody Type : Recombinant

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Addgene Comments

This antibody has been engineered from sequences from a mouse monoclonal parent antibody. By necessity, some mouse sequences are retained. When multiplexing with mouse antibodies, we recommend using Fc-directed, pre-adsorbed secondary antibodies.