Skip to main content
Addgene

Anti-Fig4/Sac3 [N202/7R]
(Antibody #192037)

Print
Western Blot image by James Trimmer, UC Davis

Image 1 (of 2): Western Blot
Crude rat membranes immunoblotted against Anti-Fig4/Sac3 [N202/7R] hybridoma-derived anti… View details
Credit: James Trimmer, UC Davis

Immunocytochemistry image by James Trimmer, UC Davis

Image 2 (of 2): Immunocytochemistry
COS cells were transfected with an antigen plasmid expressing GFP-tagged Fig4. and staine… View details
Credit: James Trimmer, UC Davis

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 192037-rAb 100 µg of purified recombinant antibody $250 *
Add to Cart
Recombinant Antibody trial size 192037-rAb.T 20 µg of purified recombinant antibody $85 *
Add to Cart

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Fig4/Sac3 [N202/7R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2916241

Terms and Licenses

Target Antigen

Protein Polyphosphoinositide phosphatase
Antigen Description Amino acids 688–907 (C-terminus) of mouse Sac3
Antigen Amino Acid Sequence
DTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKNTREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREDEGSISQRSTPVKMTDTGDSAKATENVVQPMKEVYGVSLSSSLSEEDHSIYARFVQLGQSQHKQDRGNQQLCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDTAMYREYIRNRYL
Species M. musculus (mouse)
Additional Species Reactivity H. sapiens (human),  R. norvegicus (rat)
Gene Fig4
Alternative Names
  • Phosphatidylinositol 3
  • 5-bisphosphate 5-phosphatase
  • SAC domain-containing protein 3
  • Serine-protein phosphatase FIG4
External References

Applications (1)

Information
Clear filters

Western Blot

Recommended
1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
H. sapiens (human)
Result
Pass
View Details
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Fig4/Sac3 [N202/7R] - from James Trimmer (Addgene antibody # 192037 ; http://n2t.net/addgene:192037 ; RRID:AB_2916241)

  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360