Anti-KChIP1 K+ channel [K55/7R]
(Antibody #192036)

• Purpose: Anti-KChIP1 K+ channel (Rat) recombinant mouse monoclonal antibody
• Depositing Lab: James Trimmer
• Publication: Andrews et al Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322.
• Recommended Applications: Immunohistochemistry, Immunocytochemistry

Features

• Source Species: M. musculus (mouse)
• Isotype: IgG2a
• Light Chain Type: kappa
• Amino Acid Sequences:
  Sequences (2) — Accept Affinity Reagent Sequence Policy

Production & Usage

• Production Plasmid: Anti-KChIP1 K+ channel [K55/7R]
• Purification: Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
• Storage Buffer: PBS + 1 mM sodium azide

Delivery

• Concentration: 0.9–1.1 mg/mL
• Storage: Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
• Shipment: Blue ice or room temp

Resource Information

• Persistent Resource Identifier: RRID:AB_2750667

Terms and Licenses

• Academic/Nonprofit Terms:
  • Research Use Only Terms
• Industry Terms:
  • Research Use Only Terms

Target Antigen

Protein	Kv channel-interacting protein 1
Antigen Description	Amino acids 1–227 (full-length) of rat KChIP1b
Antigen Amino Acid Sequence	MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDDLEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM View Entire Sequence
Species	R. norvegicus (rat)
Additional Species Reactivity	H. sapiens (human),  M. musculus (mouse)
Gene	Kcnip1
Alternative Names	KChIP1 A-type potassium channel modulatory protein 1 Potassium channel-interacting protein 1
External References	Uniprot ID: Q8R426

Applications (7)

Assay

All Assay Types

• Immunocytochemistry
• Immunohistochemistry
• Western Blot

Sample Species

All Sample Species

• H. sapiens (human)
• M. musculus (mouse)
• R. norvegicus (rat)
• Other

Result

Pass

Information

Application Information

×

Quality Control

Each lot of antibody undergoes testing, either in-house or through outside labs, to confirm recognition of the expected target or to confirm expected labeling across a tissue panel in one of the antibody’s recommended applications. The specific experiments performed varies for each antibody catalog item. Whenever possible, the experiment is performed in parallel with a previous lot of recombinant antibody or the hybridoma-derived equivalent to ensure potency and specificity have been retained.

Learn more: Antibody Production

Recommended Applications

These recommendations are based on a thorough review of experiments performed at Addgene or at outside labs. Addgene has partnered with outside labs in order to provide careful testing of our antibodies in applications that we are not able to test at our own facilities. Addgene works carefully with these trusted partner labs to ensure that experiments include proper controls and sufficient experimental details and these labs are denoted below with an “Addgene Partner” badge. Please note that we show results for applications that work well with our antibody (Recommended) as well as those that do not (Not recommended) so be sure to check the result!

Antibody Type

Many of Addgene’s recombinant antibodies encode sequences that were originally derived from hybridoma lines. In many cases, we provide results from assays performed with this hybridoma-derived antibody in addition to results from assays performed with the recombinant antibody. To prevent confusion, the application data represented on Addgene’s website clearly notes whether the hybridoma material or recombinant antibody material were used in the assay. In some cases, Recommended Applications are based on results from experiments performed with a hybridoma-derived antibody. If you have any trouble with the recombinant antibody for this same application please contact us at .

Immunocytochemistry

Recommended

1 image

Submitted By:: James Trimmer, UC Davis

Addgene Partner

Antibody Type : Recombinant

Sample Species : Other

Result : Pass

View Details

Immunohistochemistry

Recommended

1 image

Submitted By:: Zhuhao Wu, Weill Cornell Medicine

Addgene Partner

Antibody Type : Recombinant

Sample Species : M. musculus (mouse)

Result : Pass

View Details

1 image

Submitted By:: James Trimmer, UC Davis

Addgene Partner

Antibody Type : Recombinant

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

2 images

Submitted By:: UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Western Blot

1 image

Submitted By:: UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : H. sapiens (human)

Result : Pass

View Details

1 image

Submitted By:: UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : M. musculus (mouse)

Result : Pass

View Details

1 image

Submitted By:: UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Depositor Comments

Does not cross-react with KChIP2, KChIP3, or KChIP4