Skip to main content
Addgene

Anti-Lgi1 [N283/7R]
(Antibody #191815)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 191815-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 191815-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Lgi1 [N283/7R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Terms and Licenses

Target Antigen

Protein Leucine-rich glioma-inactivated protein 1
Antigen Description Amino acids 37–113 (LRRNT domain and first LRR repeat) of mouse Lgi1
Antigen Amino Acid Sequence
PAKPKCPAVCTCSKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIG
Species M. musculus (mouse)
Additional Species Reactivity H. sapiens (human),  R. norvegicus (rat)
Gene Lgi1
Alternative Names
  • Lgi1
External References

Applications (4)

Western Blot

1 image
Western Blot image by James Trimmer, UC Davis
Submitted By: James Trimmer, UC Davis
Addgene Partner
Antibody Type
Recombinant
Sample Species
R. norvegicus (rat)
Result
Pass
1 image
Western Blot image by Masaki Fukata, National Institute for Physiological Sciences, Japan Knockout validation
Submitted By: Masaki Fukata, National Institute for Physiological Sciences, Japan
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass
1 image
Western Blot image by Masaki Fukata, National Institute for Physiological Sciences, Japan
Submitted By: Masaki Fukata, National Institute for Physiological Sciences, Japan
Antibody Type
Hybridoma
Sample Species
R. norvegicus (rat)
Result
Pass
1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
R. norvegicus (rat)
Result
Pass

Depositor Comments

Does not cross-react with Lgi2, Lgi3 or Lgi4 (based on KO validation results)
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Lgi1 [N283/7R] - from James Trimmer (Addgene antibody # 191815 ; http://n2t.net/addgene:191815)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360