Skip to main content
Addgene

Anti-NCKX4 [N414/25R]
(Antibody #191806)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 191806-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 191806-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-NCKX4 [N414/25R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Terms and Licenses

Target Antigen

Protein Sodium/potassium/calcium exchanger 4
Antigen Description Amino acids 246–424 (third intracellular loop) of human NCKX4 isoform 3
Antigen Amino Acid Sequence
KYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQYGKNPVVMVDEIMSSSPPKFTFPEAGLRIMITNKFGPRTRLRMASRIIINERQRLINSANGVSSKPLQNGRHENIENGNVPVENPEDPQQNQEQQPPPQPPPPEPEPVEADFLSPFSVPEARGDK
Species H. sapiens (human)
Additional Species Reactivity R. norvegicus (rat)
Gene SLC24A4
Alternative Names
  • Na(+)/K(+)/Ca(2+)-exchange protein 4
  • Solute carrier family 24 member 4
External References

Applications (1)

Clear filters

Western Blot

1 image
Western Blot image by Sunita Sharma and Jonathan Lytton, University of Calgary Knockout validation
Submitted By: Sunita Sharma and Jonathan Lytton, University of Calgary
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass

Depositor Comments

Does not cross-react with NCKX2 or NCKX3
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-NCKX4 [N414/25R] - from James Trimmer (Addgene antibody # 191806 ; http://n2t.net/addgene:191806)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360