Skip to main content
Addgene

Anti-Neuroligin-1 [N97A/31R]
(Antibody #180094)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 180094-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 180094-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Neuroligin-1 [N97A/31R]
  • Antigen Plasmid
    NGL-1-myc/pEGFP-N1
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750827

Terms and Licenses

Target Antigen

Protein Neuroligin-1
Antigen Description Amino acids 718–843 (cytoplasmic C-terminus) of rat Neuroligin-1
Antigen Amino Acid Sequence
YYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
Species R. norvegicus (rat)
Additional Species Reactivity M. musculus (mouse)
Gene Nlgn1
Alternative Names
  • Neuroligin I
External References

Applications (2)

Clear filters

Western Blot

1 image
Western Blot image by Marc Bolliger and Tom Sudhof, Stanford Knockout validation
Submitted By: Marc Bolliger and Tom Sudhof, Stanford
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass
1 image
Western Blot image by
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Sample Species
M. musculus (mouse)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Neuroligin-1 [N97A/31R] - from James Trimmer (Addgene antibody # 180094 ; http://n2t.net/addgene:180094 ; RRID:AB_2750827)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360