Flag-Bcl2-Cb5
(Plasmid #18004)

• Depositing Lab: Clark Distelhorst
• Publication: Wang et al J Biol Chem. 2001 Nov 23. 276(47):44117-28.

Backbone

• Vector backbone: pCMV-Tag2B
• Backbone manufacturer: Stratagene
• Backbone size w/o insert (bp): 4300
• Vector type: Mammalian Expression
• Selectable markers: Neomycin (select with G418)

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Unknown

Gene/Insert

• Gene/Insert name: ER targeted Bcl-2
• Alt name: Bcl-2 Cb5
• Alt name: Bcl2 Cytochrome b5
• Species: H. sapiens (human)
• Insert Size (bp): 761
• Mutation: C terminal of Bcl-2 replaced with Cytochrome b5. Targets Bcl-2 to the Endoplasmic Reticulum.
• Entrez Gene: BCL2 (a.k.a. Bcl-2, PPP1R50)
• Promoter: CMV
• Tag / Fusion Protein:
  • Flag (N terminal on backbone)

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: unknown (unknown if destroyed)
• 3′ cloning site: unknown (unknown if destroyed)
• 5′ sequencing primer: T3
• 3′ sequencing primer: T7

Resource Information

• A portion of this plasmid was derived from a plasmid made by: PCR amplified human Bcl-2 from pB4 plasmid purchased from ATCC. PCR amplified Cb5 from EST purchased from ATCC.
• Articles Citing this Plasmid:
  • 2 References

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

Amino acids 100–134 (ITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED) human cytochrome b5 replaced the C-terminal domain of Bcl-2 (amino acids 219-239).