pETM33_PEX14_Pex14
(Plasmid
#178484)
-
PurposeBacterial expression of human domain with His-tag and GST tag
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 178484 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepETM33
- Backbone size w/o insert (bp) 6017
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert namePEX14_Pex14
-
SpeciesH. sapiens (human); Synthetic
-
Entrez GenePEX14 (a.k.a. NAPP2, PBD13A, Pex14p, dJ734G22.2)
- Promoter T7/LacO
-
Tag
/ Fusion Protein
- His-GST (N terminal on insert)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Nco1 (not destroyed)
- 3′ cloning site EcoR1 (not destroyed)
- 5′ sequencing primer CGGATCTGGAAGTTCTGTTCC
- 3′ sequencing primer GAGTGCGGCCGCAAGCTTG (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Please visit https://www.biorxiv.org/content/10.1101/2021.04.13.439572v1 for bioRxv preprint. Growth in BL21 DE3 gold 37 C after induction with 1mM IPTG 4 hours 30 C. Insert: GTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADEPSSL.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pETM33_PEX14_Pex14 was a gift from Ylva Ivarsson (Addgene plasmid # 178484 ; http://n2t.net/addgene:178484 ; RRID:Addgene_178484) -
For your References section:
Proteome-scale mapping of binding sites in the unstructured regions of the human proteome. Benz C, Ali M, Krystkowiak I, Simonetti L, Sayadi A, Mihalic F, Kliche J, Andersson E, Jemth P, Davey NE, Ivarsson Y. Mol Syst Biol. 2022 Jan;18(1):e10584. doi: 10.15252/msb.202110584. 10.15252/msb.202110584 PubMed 35044719