Venus-7aa-MAO-pEGFP-C3
(Plasmid #166765)

• Purpose: To target Venus to the mitochondrial outer membrane. MAO tail anchor inserts into the outer membrane and Venus faces the cytosol. Serves as a collisional control in FLIM-FRET experiments.
• Depositing Lab: David Andrews
• Publication: Andrew lab Venus and Cerulean fusions (unpublished)

Backbone

• Vector backbone: pEGFP-C3
• Vector type: Mammalian Expression
• Selectable markers: Neomycin (select with G418)

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: MAO tail anchor
• Alt name: Venus-MAO, V-MAO
• Species: H. sapiens (human)
• Entrez Gene: MAOA (a.k.a. BRNRS, MAO-A)
• Promoter: CMV
• Tag / Fusion Protein:
  • Venus (N terminal on backbone)

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: Unknown (unknown if destroyed)
• 3′ cloning site: Unknown (unknown if destroyed)
• 5′ sequencing primer: TGACGCAAATGGGCGGTAGG
• 3′ sequencing primer: TCGCCCTTTGACGTTGGAGTCCAC

Resource Information

• Supplemental Documents:
  • Venus-7aa-MAO-pEGFP-C3.gb
• A portion of this plasmid was derived from a plasmid made by: See gene entry for "Monoamine oxidase-A [Homo sapiens]" See NCBI Reference Sequence: NP_001257387.1. Here we have used only the C-terminal tail anchor sequence.

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

"WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.