Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

GLuc-FLAG-CB1
(Plasmid #158066)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 158066 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    PX459v2
  • Backbone manufacturer
    Feng Zhang's Lab
  • Backbone size w/o insert (bp) 9175
  • Total vector size (bp) 10146
  • Modifications to backbone
    Promoter: chicken β-actin promoter with CMV enhancer
  • Vector type
    Mammalian Expression, AAV

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    NEB Stable
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    CB1
  • Alt name
    CNR1 cannabinoid receptor 1
  • Species
    H. sapiens (human)
  • Insert Size (bp)
    5996
  • Mutation
    contains 4Kb of 3' UTR
  • GenBank ID
    1268
  • Entrez Gene
    CNR1 (a.k.a. CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR)
  • Promoter pCAG
  • Tag / Fusion Protein
    • Gaussia Luciferase (N terminal on insert)

Cloning Information

  • Cloning method Gibson Cloning
  • 5′ sequencing primer ggctgtaattagctgagcaagagg
  • 3′ sequencing primer GCTGTCCTGCCCCACCCCAC
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Note that the Addgene verified sequence contains a few ambiguous nucleotides in the CAG promoter region. These discrepancies do not impact plasmid function and are likely due to difficulties sequencing GC-rich regions. The N-terminus of GLuc-Flag-CB1 contains additional residues (MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASNCFN) which match DnaE-C (NCBI reference WP_114085349.1).

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    GLuc-FLAG-CB1 was a gift from Adolfo Rivero-Muller (Addgene plasmid # 158066 ; http://n2t.net/addgene:158066 ; RRID:Addgene_158066)
  • For your References section:

    A novel bioassay for quantification of surface Cannabinoid receptor 1 expression. Rodriguez-Rodriguez I, Kalafut J, Czerwonka A, Rivero-Muller A. Sci Rep. 2020 Oct 23;10(1):18191. doi: 10.1038/s41598-020-75331-y. 10.1038/s41598-020-75331-y PubMed 33097803