Skip to main content
Addgene

pETM33_Nsp16
(Plasmid #156482)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 156482 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pETM33
  • Backbone size w/o insert (bp) 6017
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Growth instructions
    Growth in BL21 DE3 gold 37˚C after induction with 1mM 16hours 18˚C
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    Nsp16
  • Species
    Synthetic; Severe acute respiratory syndrome coronavirus 2
  • Mutation
    Gene insert is codon optimized for Ecoli.
  • Entrez Gene
    ORF1ab (a.k.a. GU280_gp01)
  • Promoter T7/LacO
  • Tag / Fusion Protein
    • His-GST (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Nco1 (destroyed during cloning)
  • 3′ cloning site EcoR1 (destroyed during cloning)
  • 5′ sequencing primer CGGATCTGGAAGTTCTGTTCC
  • 3′ sequencing primer GAGTGCGGCCGCAAGCTTG
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

insert amino acid sequence: lqssqawqpgvampnlykmqrmllekcdlqnygdsatlpkgimmnvakytqlcqylntltlavpynmrvihfgagsdkgvapgtavlrqwlptgtllvdsdlndfvsdadstligdcatvhtankwdliisdmydpktknvtkendskegfftyicgfiqqklalggsvaikitehswnadlyklmghfawwtafvtnvnassseafligcnylgkpreqidgyvmhanyifwrntnpiqlssyslfdmskfplklrgtavmslkegqindmilsllskgrliirennrvvis

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pETM33_Nsp16 was a gift from Ylva Ivarsson (Addgene plasmid # 156482 ; http://n2t.net/addgene:156482 ; RRID:Addgene_156482)
  • For your References section:

    Identification of motif-based interactions between SARS-CoV-2 protein domains and human peptide ligands pinpoint antiviral targets. Mihalic F, Benz C, Kassa E, Lindqvist R, Simonetti L, Inturi R, Aronsson H, Andersson E, Chi CN, Davey NE, Overby AK, Jemth P, Ivarsson Y. Nat Commun. 2023 Sep 13;14(1):5636. doi: 10.1038/s41467-023-41312-8. 10.1038/s41467-023-41312-8 PubMed 37704626