Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

ppih.001.177.W133A
(Plasmid #137655)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 137655 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pET28GST-LIC
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Low Copy

Gene/Insert

  • Gene/Insert name
    ppih
  • Species
    H. sapiens (human)
  • Mutation
    001-177-W133A
  • Entrez Gene
    PPIH (a.k.a. CYP-20, CYPH, SnuCyp-20, USA-CYP)
  • Tag / Fusion Protein
    • GST-(His)6-thrombin (N terminal on backbone)

Cloning Information

  • Cloning method Ligation Independent Cloning
  • 5′ sequencing primer T7F and LIC primer: cctgctctaagtgcgatgcgctggatgggaag
  • 3′ sequencing primer T7R and LIC primer: tgcttcccatccagcgcatcgcacttagagcagg
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPRGSMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDALDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    ppih.001.177.W133A was a gift from Tara Davis & Melissa Jurica (Addgene plasmid # 137655 ; http://n2t.net/addgene:137655 ; RRID:Addgene_137655)
  • For your References section:

    The spliceosomal proteins PPIH and PRPF4 exhibit bi-partite binding. Rajiv C, Jackson SR, Cocklin S, Eisenmesser EZ, Davis TL. Biochem J. 2017 Oct 25;474(21):3689-3704. doi: 10.1042/BCJ20170366. 10.1042/BCJ20170366 PubMed 28935721