Skip to main content
Addgene

integrin alpha9 pBabe puro
(Plasmid #13604)

Full plasmid sequence is not available for this item.

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 13604 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pBabe puro
  • Backbone manufacturer
    Available at Addgene (plasmid #1764)
  • Backbone size w/o insert (bp) 5169
  • Vector type
    Mammalian Expression, Retroviral
  • Selectable markers
    Puromycin

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    integrin alpha 9
  • Alt name
    ITGA9
  • Species
    H. sapiens (human)
  • Insert Size (bp)
    3200
  • Mutation
    contains mature ITGA9 (aa30-1035 compared to NP_002198.2)
  • GenBank ID
    NM_002207
  • Entrez Gene
    ITGA9 (a.k.a. ALPHA-RLC, ITGA4L, RLC)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site HindIII/SnaBI (destroyed during cloning)
  • 3′ cloning site XbaI/SnaBI (destroyed during cloning)
  • 5′ sequencing primer pBABE-5
  • 3′ sequencing primer pBABE-3
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

See author's map for additional restriction sites.

An ITGA5 signal peptide sequence (MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLVPPPPRVGG) is present immediately before the start of ITGA9 at amino acid 30.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    integrin alpha9 pBabe puro was a gift from Dean Sheppard (Addgene plasmid # 13604 ; http://n2t.net/addgene:13604 ; RRID:Addgene_13604)