Skip to main content
Addgene

pc3XB-ZF14
(Plasmid #13113)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 13113 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pc3XB
  • Backbone manufacturer
    Modified Invitrogen pcDNA3
  • Backbone size w/o insert (bp) 5400
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    XL1 Blue
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    ZF14
  • Insert Size (bp)
    90

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site XbaI (not destroyed)
  • 3′ cloning site BamHI (not destroyed)
  • 5′ sequencing primer T7
  • (Common Sequencing Primers)

Terms and Licenses

Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPHICHIQGCGKVYGDRSALARHLRWH. Target DNA sequence: GTC. This zinc finger is derived from the Sangamo module set.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pc3XB-ZF14 was a gift from Keith Joung (Addgene plasmid # 13113 ; http://n2t.net/addgene:13113 ; RRID:Addgene_13113)
  • For your References section:

    Standardized reagents and protocols for engineering zinc finger nucleases by modular assembly. Wright DA, Thibodeau-Beganny S, Sander JD, Winfrey RJ, Hirsh AS, Eichtinger M, Fu F, Porteus MH, Dobbs D, Voytas DF, Joung JK. Nat Protoc. 2006;1(3):1637-52. doi: 10.1038/nprot.2006.259 10.1038/nprot.2006.259 PubMed 17406455