-
PurposeHomology arms and linker-mEGFP sequence for C-terminus tagging of human FUS
-
Depositing Lab
-
Publication
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 114410 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 * |
* Log in to view industry pricing.
Backbone
-
Vector backbonepUC57
-
Vector typeMammalian Expression, CRISPR ; Donor Template
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameFUS Homology Arms with linker-mEGFP
-
SpeciesH. sapiens (human)
-
Insert Size (bp)2882
-
Mutationhomology arms contain point mutations to disrupt crRNA binding sites used, and WTC-specific homozygous SNP(s)
-
Entrez GeneFUS (a.k.a. ALS6, ETM4, FUS1, HNRNPP2, POMP75, TLS, altFUS)
-
Tag
/ Fusion Protein
- linker-mEGFP (C terminal on insert)
Cloning Information
- Cloning method Unknown
Resource Information
-
Supplemental Documents
-
Article Citing this Plasmid
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
This plasmid has been used with locus-specific CRISPR/Cas9 to add a mEGFP tag to the C-terminus of human FUS in WTC human induced pluripotent stem cells by the Allen Institute for Cell Science. Linker (AA) sequence: ENLYFQGAAKFKETAAAKFERQHMDSGGGGSSGPSGSSSLEVLFQGPLSSSGPSGS. After protein tagging using this donor template plasmid and CRISPR/Cas9 reagents, transfected cells may exhibit varying intensity levels of fluorescence, likely due to editing precision. To obtain cells of uniform intensity levels, see our protocol for fluorescence-assisted cell sorting and subcloning of transfected cells (https://www.allencell.org/instructional-videos-and-tutorials-for-cell-methods.html) Further, we recommend PCR-based assays for identifying precisely edited clones as previously described (https://www.molbiolcell.org/doi/abs/10.1091/mbc.e17-03-0209) For more information on the entire plasmid collection, please see https://www.addgene.org/allen-institute-cell-science/ .
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
AICSDP-64: FUS-mEGFP was a gift from Allen Institute for Cell Science (Addgene plasmid # 114410 ; http://n2t.net/addgene:114410 ; RRID:Addgene_114410)