eGFP-PRM-5R
(Plasmid #112155)

• Purpose: Mammalian expression plasmid for PRM-5R in a vector expressing eGFP.
• Depositing Lab: Michael Rosen
• Publication: Li et al Nature. 2012 Mar 7;483(7389):336-40. doi: 10.1038/nature10879.

Backbone

• Vector backbone: pEGFP-N1
• Backbone manufacturer: Clontech
• Backbone size w/o insert (bp): 4700
• Total vector size (bp): 5055
• Vector type: Mammalian Expression
• Selectable markers: Neomycin (select with G418)

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Unknown

Gene/Insert

• Gene/Insert name: PRM-5R
• Alt name: 5 repeats of the PRM domain of ABl1
• Species: H. sapiens (human)
• Insert Size (bp): 355
• Mutation: contains only the PRM domain of Abl1
• GenBank ID:
• Entrez Gene: ABL1 (a.k.a. ABL, BCR-ABL, CHDSKM, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl)
• Promoter: CMV

Cloning Information

• Cloning method: Restriction Enzyme
• 5′ cloning site: EcoRI (not destroyed)
• 3′ cloning site: AgeI (not destroyed)
• 5′ sequencing primer: EGFP-N Sequencing Primer (CMV forward primer): 5'-CGCAAATGGGCGGTAGGCGTG-3'
• 3′ sequencing primer: EGFPstrt-3: 5'-CTCGCCCTTGCTCACCAT-3'

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

protein sequence:
HMKGGSWGGSAPPPPPPSRGWGSGGSGGSGGSAPPPPPPSRGGGGSGGSGGSGGSAPPPPPPSRGGGGSRDPGGSGGSGGSAPPPPPPSRGWGSGGSGGSGGSAPPPPPPSRGGGGSPVAT