Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

eGFP-PRM-5R
(Plasmid #112155)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 112155 Standard format: Plasmid sent in bacteria as agar stab 1 $85

Backbone

  • Vector backbone
    pEGFP-N1
  • Backbone manufacturer
    Clontech
  • Backbone size w/o insert (bp) 4700
  • Total vector size (bp) 5055
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    PRM-5R
  • Alt name
    5 repeats of the PRM domain of ABl1
  • Species
    H. sapiens (human)
  • Insert Size (bp)
    355
  • Mutation
    contains only the PRM domain of Abl1
  • GenBank ID
  • Entrez Gene
    ABL1 (a.k.a. ABL, BCR-ABL, CHDSKM, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl)
  • Promoter CMV

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site EcoRI (not destroyed)
  • 3′ cloning site AgeI (not destroyed)
  • 5′ sequencing primer EGFP-N Sequencing Primer (CMV forward primer): 5'-CGCAAATGGGCGGTAGGCGTG-3'
  • 3′ sequencing primer EGFPstrt-3: 5'-CTCGCCCTTGCTCACCAT-3'
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

protein sequence:
HMKGGSWGGSAPPPPPPSRGWGSGGSGGSGGSAPPPPPPSRGGGGSGGSGGSGGSAPPPPPPSRGGGGSRDPGGSGGSGGSAPPPPPPSRGWGSGGSGGSGGSAPPPPPPSRGGGGSPVAT

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    eGFP-PRM-5R was a gift from Michael Rosen (Addgene plasmid # 112155 ; http://n2t.net/addgene:112155 ; RRID:Addgene_112155)
  • For your References section:

    Phase transitions in the assembly of multivalent signalling proteins. Li P, Banjade S, Cheng HC, Kim S, Chen B, Guo L, Llaguno M, Hollingsworth JV, King DS, Banani SF, Russo PS, Jiang QX, Nixon BT, Rosen MK. Nature. 2012 Mar 7;483(7389):336-40. doi: 10.1038/nature10879. 10.1038/nature10879 PubMed 22398450