pET-30a(+)-C-SH2+IA
(Plasmid
#111418)
-
Purposeexpress murine Syk (C)SH2 domain plus interdomain A (Phe 119 to Gln 264), in E.coli strain Rosetta 2 (DE3)
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 111418 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
Backbone
-
Vector backbonepET-30a(+)
-
Backbone manufacturerNovagen
- Backbone size w/o insert (bp) 5422
- Total vector size (bp) 5682
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert namemurine Syk (C)SH2 domain plus interdomain A (Phe 119 to Gln 264), without any tag
-
Alt nameSpleen tyrosine kinase (C)SH2 domain plus interdomain A
-
SpeciesM. musculus (mouse)
-
Insert Size (bp)453
-
GenBank IDNP_035648
-
Entrez GeneSyk (a.k.a. Sykb)
- Promoter T7 promoter
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Nde I (unknown if destroyed)
- 3′ cloning site Xho I (unknown if destroyed)
- 5′ sequencing primer T7 promoter
- 3′ sequencing primer T7 terminator (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
encoding the following protein sequence: MFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pET-30a(+)-C-SH2+IA was a gift from Carol Post (Addgene plasmid # 111418 ; http://n2t.net/addgene:111418 ; RRID:Addgene_111418) -
For your References section:
Entropic allostery dominates the phosphorylation-dependent regulation of Syk tyrosine kinase release from immunoreceptor tyrosine-based activation motifs. Feng C, Roy A, Post CB. Protein Sci. 2018 Jul 27. doi: 10.1002/pro.3489. 10.1002/pro.3489 PubMed 30051939