pET-30a(+)-N-SH2+IA
(Plasmid
#111273)
-
Purposeexpress murine Syk (N)SH2 domain plus interdomain A (Ser 8 to His 162), with an N-terminal (His)6 tag and TEV cleavage site, in E.coli strain Rosetta 2 (DE3)
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 111273 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepET-30a(+)
-
Backbone manufacturerNovagen
- Backbone size w/o insert (bp) 5422
- Total vector size (bp) 5748
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert namemurine Syk (N)SH2 domain plus interdomain A (Ser 8 to His 162), with an N-terminal (His)6 tag and TEV cleavage site
-
Alt nameSpleen tyrosine kinase (N)SH2 domain plus interdomain A
-
SpeciesM. musculus (mouse)
-
Insert Size (bp)519
-
GenBank IDNP_035648
-
Entrez GeneSyk (a.k.a. Sykb)
- Promoter T7 promoter
-
Tag
/ Fusion Protein
- HHHHHHENLYFQG (N terminal on insert)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Nde I (unknown if destroyed)
- 3′ cloning site Xho I (unknown if destroyed)
- 5′ sequencing primer T7 promoter
- 3′ sequencing primer T7 terminator (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAH
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pET-30a(+)-N-SH2+IA was a gift from Carol Post (Addgene plasmid # 111273 ; http://n2t.net/addgene:111273 ; RRID:Addgene_111273) -
For your References section:
Insights into the allosteric regulation of Syk association with receptor ITAM, a multi-state equilibrium. Feng C, Post CB. Phys Chem Chem Phys. 2016 Feb 17;18(8):5807-18. doi: 10.1039/c5cp05417f. 10.1039/c5cp05417f PubMed 26468009